Loading...
Statistics
Advertisement

Bionica
www.bionica.cl/
Bionica,Agencia virtual,Marketing on line,

Bionica.cl

Advertisement
Conversion Technology Metas Server
Bionica.cl is hosted in Chile / Santiago . Bionica.cl uses HTTPS protocol. Number of used technologies: 6. First technologies: CSS, Html, Javascript, Number of used javascripts: 8. First javascripts: Mootools.js, Caption.js, Jquery.js, Number of used analytics tools: 0. Its server type is: Apache.

Technologies in use by Bionica.cl

Technology

Number of occurences: 6
  • CSS
  • Html
  • Javascript
  • jQuery
  • MooTools
  • Php

Advertisement

Javascripts

Number of occurences: 8
  • mootools.js
  • caption.js
  • jquery.js
  • widgetkit-0d1a5d9c.js
  • warp.js
  • accordionmenu.js
  • dropdownmenu.js
  • template.js

Server Type

  • Apache

Powered by

  • PHP/5.5.34

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Bionica.cl

SSL certificate

    • name: /CN=ssl.blaster/OU=IT/ST=Metropolitana/O=Hostname/emailAddress=r@hn.cl/C=CL/L=Santiago
    • subject:
      • CN: ssl.blaster
      • OU: IT
      • ST: Metropolitana
      • O: Hostname
      • emailAddress: r@hn.cl
      • C: CL
      • L: Santiago
    • hash: 10fadc3b
    • issuer:
      • CN: ssl.blaster
      • OU: IT
      • ST: Metropolitana
      • O: Hostname
      • emailAddress: r@hn.cl
      • C: CL
      • L: Santiago
    • version: 2
    • serialNumber: 5143256662
    • validFrom: 160405213626Z
    • validTo: 170405213626Z
    • validFrom_time_t: 1459892186
    • validTo_time_t: 1491428186
    • extensions:
      • subjectKeyIdentifier: 19:8B:5D:21:B6:52:E5:62:FB:5E:BE:AA:80:C5:EB:E8:3C:D8:12:78
      • authorityKeyIdentifier: keyid:19:8B:5D:21:B6:52:E5:62:FB:5E:BE:AA:80:C5:EB:E8:3C:D8:12:78
      • basicConstraints: CA:TRUE

Meta - Bionica.cl

Number of occurences: 6
  • Name:
    Content:
  • Name: robots
    Content: index, follow
  • Name: keywords
    Content: Bionica,Agencia virtual,Marketing on line,cotizá,diseño web
  • Name: author
    Content: Administrator
  • Name: description
    Content: Bionica,Agencia virtual,Marketing on line,
  • Name: generator
    Content: Joomla! 1.5 - Open Source Content Management

Server / Hosting

  • IP: 190.110.123.213
  • Latitude: -33.46
  • Longitude: -70.67
  • Country: Chile
  • City: Santiago

Rname

  • ns1.inc.cl
  • ns2.inc.cl
  • bionica.cl

Target

  • reportes.hostname.cl

HTTP Header Response

HTTP/1.1 200 OK Date: Mon, 29 Aug 2016 06:36:26 GMT Server: Apache X-Powered-By: PHP/5.5.34 P3P: CP="NOI ADM DEV PSAi COM NAV OUR OTRo STP IND DEM" Expires: Mon, 1 Jan 2001 00:00:00 GMT Cache-Control: post-check=0, pre-check=0 Pragma: no-cache Set-Cookie: dd09bbf756a153f4a6d848718ed5dfad=2782e55bc42d05ee47527d0228da9ca9; path=/ Last-Modified: Mon, 29 Aug 2016 06:36:27 GMT Content-Length: 13651 Content-Type: text/html; charset=utf-8 X-Cache: MISS from s_mf40 X-Cache-Lookup: MISS from s_mf40:80 Via: 1.1 s_mf40 (squid/3.5.20) Connection: keep-alive

DNS

host: bionica.cl
  1. class: IN
  2. ttl: 14400
  3. type: A
  4. ip: 190.110.123.213
host: bionica.cl
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns1.inc.cl
host: bionica.cl
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns2.inc.cl
host: bionica.cl
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns1.inc.cl
  5. rname: reportes.hostname.cl
  6. serial: 2016040300
  7. refresh: 86400
  8. retry: 7200
  9. expire: 3600000
  10. minimum-ttl: 86400
host: bionica.cl
  1. class: IN
  2. ttl: 14400
  3. type: MX
  4. pri: 0
  5. target: bionica.cl
host: bionica.cl
  1. class: IN
  2. ttl: 14400
  3. type: TXT
  4. txt: v=spf1 ip4:190.110.123.213 a mx include:websitewelcome.com ~all
  5. entries: Array

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.ionica.cl, www.bqionica.cl, www.qionica.cl, www.bwionica.cl, www.wionica.cl, www.bzionica.cl, www.zionica.cl, www.bxionica.cl, www.xionica.cl, www.bionica.cl, www.ionica.cl, www.bsionica.cl, www.sionica.cl, www.byionica.cl, www.yionica.cl, www.beionica.cl, www.eionica.cl, www.bdionica.cl, www.dionica.cl, www.bcionica.cl, www.cionica.cl, www.bonica.cl, www.bironica.cl, www.bronica.cl, www.bifonica.cl, www.bfonica.cl, www.bivonica.cl, www.bvonica.cl, www.bikonica.cl, www.bkonica.cl, www.bi,onica.cl, www.b,onica.cl, www.bibonica.cl, www.bbonica.cl, www.bigonica.cl, www.bgonica.cl, www.bitonica.cl, www.btonica.cl, www.biyonica.cl, www.byonica.cl, www.biuonica.cl, www.buonica.cl, www.bijonica.cl, www.bjonica.cl, www.bimonica.cl, www.bmonica.cl, www.binonica.cl, www.bnonica.cl, www.binica.cl, www.biobnica.cl, www.bibnica.cl, www.biohnica.cl, www.bihnica.cl, www.biognica.cl, www.bignica.cl, www.biojnica.cl, www.bijnica.cl, www.biomnica.cl, www.bimnica.cl, www.bio nica.cl, www.bi nica.cl, www.biovnica.cl, www.bivnica.cl, www.bioica.cl, www.bionnica.cl, www.bionica.cl, www.bionhica.cl, www.biohica.cl, www.bionjica.cl, www.biojica.cl, www.bionkica.cl, www.biokica.cl, www.bionlica.cl, www.biolica.cl, www.bion ica.cl, www.bio ica.cl, www.bionca.cl, www.bionirca.cl, www.bionrca.cl, www.bionifca.cl, www.bionfca.cl, www.bionivca.cl, www.bionvca.cl, www.bionikca.cl, www.bionkca.cl, www.bioni,ca.cl, www.bion,ca.cl, www.bionibca.cl, www.bionbca.cl, www.bionigca.cl, www.biongca.cl, www.bionitca.cl, www.biontca.cl, www.bioniyca.cl, www.bionyca.cl, www.bioniuca.cl, www.bionuca.cl, www.bionijca.cl, www.bionjca.cl, www.bionimca.cl, www.bionmca.cl, www.bioninca.cl, www.bionnca.cl, www.bionia.cl, www.bionicda.cl, www.bionida.cl, www.bionicra.cl, www.bionira.cl, www.bionicta.cl, www.bionita.cl, www.bionicva.cl, www.bioniva.cl, www.bionicfa.cl, www.bionifa.cl, www.bionicga.cl, www.bioniga.cl, www.bionicha.cl, www.bioniha.cl, www.bionicna.cl, www.bionina.cl, www.bionicma.cl, www.bionima.cl, www.bionicja.cl, www.bionija.cl, www.bionic.cl, www.bionicao.cl, www.bionico.cl, www.bionicap.cl, www.bionicp.cl, www.bionica9.cl, www.bionic9.cl, www.bionica.cl, www.bionic.cl, www.bionicai.cl, www.bionici.cl, www.bionicau.cl, www.bionicu.cl,

Other websites we recently analyzed

  1. Ãœber uns | cairos-academy
    Germany - 78.47.220.105
    Server software: Apache
    Technology: CSS, Html
    Number of meta tags: 1
  2. miscmannamagalginknimatnyasvetchargapoleaz
    San Francisco (United States) - 192.0.78.13
    Server software: nginx
    Technology: Skimlinks, CSS, Gravatar, Html, Html5, Javascript, Php, Pingback, Shortcodes, comScore, Wordpress, Twitter Button
    Number of Javascript: 8
    Number of meta tags: 7
  3. ¿Ã‹Ã‚¡ÍõվȺ ÁªÏµQQ£º1785605588
    Kansas City (United States) - 173.208.215.148
    Server software: Microsoft-IIS/6.0
    Technology: Html
    Number of meta tags: 1
  4. Restaurant La Ripaille
    Le restaurant La Ripaille est situé à Arromanches, nous vous proposons une cuisine Normande traditionnelle.
    France - 213.186.33.104
    G Analytics ID: UA-441859-8
    Server software: Apache
    Technology: Carousel, CSS, Html, Html5, Iframe, Javascript, Google Analytics
    Number of Javascript: 2
    Number of meta tags: 4
  5. Tennessee Career Centers
    Columbia (United States) - 66.211.30.3
    G Analytics ID: UA-39861102-1
    Server software:
    Technology: CSS, Html, Iframe, Javascript, Php, Swf Object, Google Analytics, Facebook Like box
    Number of Javascript: 4
    Number of meta tags: 1
  6. Home | Instant Spark
    Scottsdale (United States) - 173.201.243.1
    Server software: Apache
    Technology: Html
  7. Die Potsdam Lions
    Germany - 212.90.148.98
    Server software: Apache/2.2.31
    Technology: Html, Php
    Number of meta tags: 1
  8. Dorcas Clothing :: Wholesale Clothing
    Dorcas is a fashion wholesaler specializing in women's apparel located in Los Angeles fashion district. We offer the latest fashion at the best quality and price.
    Montréal (Canada) - 184.107.203.99
    Server software: Apache
    Technology: CSS, Html, Javascript, jQuery Cycle, jQuery UI, Lightbox, Php
    Number of Javascript: 10
    Number of meta tags: 10
  9. THE NEW MILLIONS
    New York (United States) - 198.185.159.145
    Server software:
    Technology: CSS, Html, Iframe, Javascript, Lightbox, Php, Squarespace
    Number of Javascript: 2
    Number of meta tags: 7
  10. ماشین های اداری امیران
    امیران ماشین
    Iran, Islamic Republic of - 185.8.172.176
    Server software: Apache
    Technology: CSS, Font Awesome, Html, Html5, Javascript, Php, SVG
    Number of Javascript: 4
    Number of meta tags: 3

Check Other Websites